PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00101.100
Common NameAMTR_s00101p00128190, LOC18427126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 292aa    MW: 32040.9 Da    PI: 6.9201
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00101.100genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.4e-3187140155
                                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                               +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00101.100  87 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMNVDGLTRENVASHLQKYRL 140
                                               59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.61E-2084144IPR009057Homeodomain-like
PROSITE profilePS5129411.29884143IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-3186145IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-2488140IPR006447Myb domain, plants
PfamPF002491.9E-890139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MKDEDGNNNN WFSRWEDDLP PPEELMPLSQ SLITPDLAQA FQIHKLPDPP GPLPELSELP  60
EHPVQLPEPS SPPELLSSDE PARTLKRPRL VWTPQLHKRF VDAVAHLGIK NAVPKTIMQL  120
MNVDGLTREN VASHLQKYRL YLKRMQGLSP EAQGQGTHDH LFSQAGHHHH HGLVHHRGAE  180
DVFSGQVGLT TIHNAHHQFH HHHQSPYQSQ GHHHQQHHIA SGGVGFFDHR FLGRPQHHQG  240
MVGGRVGVGP GGVLGPATAA AGIGGGVVQV EDVEGSSPPR KVLTLFPTAD D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-2186145463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00056PBMTransfer from AT5G05090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011620754.10.0PREDICTED: transcription factor PCL1
SwissprotQ9LTH42e-41PCLL_ARATH; Transcription factor BOA
TrEMBLW1NUW00.0W1NUW0_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr8P05880_0011e-63(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.12e-46G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]